SCOPe 2.01: Domain d1w8oa2: 1w8o A:506-647

Lineage for d1w8oa2 (1w8o A:506-647)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)

6. Protein Sialidase, C-terminal domain [49789] (1 species)

7. Species Micromonospora viridifaciens [TaxId:1881] [49790] (6 PDB entries)
   Uniprot Q02834 47-647

8. Domain d1w8oa2: 1w8o A:506-647 [114375]
   Other proteins in same PDB: d1w8oa1, d1w8oa3
   complexed with cit, gol, lbt, na

Details for d1w8oa2

PDB Entry: 1w8o, 1.7 Å

PDB Description: contribution of the active site aspartic acid to catalysis in the bacterial neuraminidase from micromonospora viridifaciens

PDB Compounds: (A:) bacterial sialidase

SCOPe Domain Sequences for d1w8oa2:

Sequence; same for both SEQRES and ATOM records:

>d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr

Timeline for d1w8oa2:

• d1w8oa2 first appeared in SCOP 1.71
  
• d1w8oa2 appears in SCOP 1.75
  
• d1w8oa2 appears in SCOPe 2.02
  
• d1w8oa2 appears in the current release, SCOPe 2.08