![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.1: Galactose-binding domain [49786] (2 proteins) automatically mapped to Pfam PF00754 |
![]() | Protein Sialidase, C-terminal domain [49789] (1 species) |
![]() | Species Micromonospora viridifaciens [TaxId:1881] [49790] (4 PDB entries) Uniprot Q02834 47-647 |
![]() | Domain d1w8oa2: 1w8o A:506-647 [114375] Other proteins in same PDB: d1w8oa1, d1w8oa3 complexed with cit, gol, na |
PDB Entry: 1w8o (more details), 1.7 Å
SCOPe Domain Sequences for d1w8oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv alseqtghkyaavaelevegqr
Timeline for d1w8oa2: