Lineage for d1w8oa1 (1w8o A:403-505)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789056Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 789293Protein Sialidase, "linker" domain [49237] (1 species)
    follows the catalytic six-bladed beta-propeller domain
  7. 789294Species Micromonospora viridifaciens [TaxId:1881] [49238] (6 PDB entries)
    Uniprot Q02834 47-647
  8. 789295Domain d1w8oa1: 1w8o A:403-505 [114374]
    Other proteins in same PDB: d1w8oa2, d1w8oa3
    complexed with cit, gol, lbt, na; mutant

Details for d1w8oa1

PDB Entry: 1w8o (more details), 1.7 Å

PDB Description: contribution of the active site aspartic acid to catalysis in the bacterial neuraminidase from micromonospora viridifaciens
PDB Compounds: (A:) bacterial sialidase

SCOP Domain Sequences for d1w8oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8oa1 b.1.18.2 (A:403-505) Sialidase, "linker" domain {Micromonospora viridifaciens [TaxId: 1881]}
gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld

SCOP Domain Coordinates for d1w8oa1:

Click to download the PDB-style file with coordinates for d1w8oa1.
(The format of our PDB-style files is described here.)

Timeline for d1w8oa1: