Lineage for d1w8na1 (1w8n A:403-505)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765186Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2765430Protein Sialidase, linker domain [49237] (1 species)
    follows the catalytic six-bladed beta-propeller domain
  7. 2765431Species Micromonospora viridifaciens [TaxId:1881] [49238] (4 PDB entries)
    Uniprot Q02834 47-647
  8. 2765433Domain d1w8na1: 1w8n A:403-505 [114371]
    Other proteins in same PDB: d1w8na2, d1w8na3
    complexed with dan, gal, na

Details for d1w8na1

PDB Entry: 1w8n (more details), 2.1 Å

PDB Description: contribution of the active site aspartic acid to catalysis in the bacterial neuraminidase from micromonospora viridifaciens.
PDB Compounds: (A:) bacterial sialidase

SCOPe Domain Sequences for d1w8na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8na1 b.1.18.2 (A:403-505) Sialidase, linker domain {Micromonospora viridifaciens [TaxId: 1881]}
gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld

SCOPe Domain Coordinates for d1w8na1:

Click to download the PDB-style file with coordinates for d1w8na1.
(The format of our PDB-style files is described here.)

Timeline for d1w8na1: