![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (3 families) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins) |
![]() | Protein Cyclophilin (eukaryotic) [50893] (13 species) |
![]() | Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (48 PDB entries) |
![]() | Domain d1w8la_: 1w8l A: [114369] complexed with 1p3 |
PDB Entry: 1w8l (more details), 1.8 Å
SCOP Domain Sequences for d1w8la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w8la_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]} mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
Timeline for d1w8la_: