Lineage for d1w8dc_ (1w8d C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574451Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (53 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 574494Protein 2,4-dienoyl-CoA reductase, mitochondrial (DECR) [117421] (1 species)
  7. 574495Species Human (Homo sapiens), [TaxId:9606] [117422] (3 PDB entries)
  8. 574506Domain d1w8dc_: 1w8d C: [114366]

Details for d1w8dc_

PDB Entry: 1w8d (more details), 2.2 Å

PDB Description: binary structure of human decr.

SCOP Domain Sequences for d1w8dc_:

Sequence, based on SEQRES records: (download)

>d1w8dc_ c.2.1.2 (C:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens),}
tealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkmdv
lkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispter
lspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasaka
gveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgtve
elanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieel

Sequence, based on observed residues (ATOM records): (download)

>d1w8dc_ c.2.1.2 (C:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens),}
tealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkmdv
lkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispter
lspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasaka
gveamskslaaewgkygmrfnviqpgpikttgtfekemigripcgrlgtveelanlaafl
csdyaswingavikfdggeevlisgefndlrkvtkeqwdtieel

SCOP Domain Coordinates for d1w8dc_:

Click to download the PDB-style file with coordinates for d1w8dc_.
(The format of our PDB-style files is described here.)

Timeline for d1w8dc_: