Lineage for d1w8dc_ (1w8d C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2090728Protein 2,4-dienoyl-CoA reductase, mitochondrial (DECR) [117421] (1 species)
  7. 2090729Species Human (Homo sapiens) [TaxId:9606] [117422] (3 PDB entries)
    Uniprot Q16698 35-328
  8. 2090740Domain d1w8dc_: 1w8d C: [114366]
    complexed with gol, nap

Details for d1w8dc_

PDB Entry: 1w8d (more details), 2.2 Å

PDB Description: binary structure of human decr.
PDB Compounds: (C:) 2,4-dienoyl-coa reductase, mitochondrial precursor

SCOPe Domain Sequences for d1w8dc_:

Sequence, based on SEQRES records: (download)

>d1w8dc_ c.2.1.2 (C:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens) [TaxId: 9606]}
tealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkmdv
lkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispter
lspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasaka
gveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgtve
elanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieel

Sequence, based on observed residues (ATOM records): (download)

>d1w8dc_ c.2.1.2 (C:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens) [TaxId: 9606]}
tealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkmdv
lkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispter
lspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasaka
gveamskslaaewgkygmrfnviqpgpikttgtfekemigripcgrlgtveelanlaafl
csdyaswingavikfdggeevlisgefndlrkvtkeqwdtieel

SCOPe Domain Coordinates for d1w8dc_:

Click to download the PDB-style file with coordinates for d1w8dc_.
(The format of our PDB-style files is described here.)

Timeline for d1w8dc_: