Lineage for d1w8aa_ (1w8a A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823992Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 824043Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 824152Family c.10.2.7: Ngr ectodomain-like [75142] (6 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 824170Protein Slit [117461] (1 species)
  7. 824171Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117462] (1 PDB entry)
    Uniprot P24014 542-733
  8. 824172Domain d1w8aa_: 1w8a A: [114363]
    3rd LRR domain

Details for d1w8aa_

PDB Entry: 1w8a (more details), 2.8 Å

PDB Description: third lrr domain of drosophila slit
PDB Compounds: (A:) slit protein

SCOP Domain Sequences for d1w8aa_:

Sequence, based on SEQRES records: (download)

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dcpamchcegttvdctgrglkeiprdiplhttelllndnelgrissdglfgrlphlvkle
lkrnqltgiepnafegashiqelqlgenkikeisnkmflglhqlktlnlydnqiscvmpg
sfehlnsltslnlasnpfncnchlawfaewlrkkslnggaarcgapskvrdvqikdlphs
efkcssensegc

Sequence, based on observed residues (ATOM records): (download)

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dcpamchcegttvdctgrglkeiprdiplhttelllndnelgrissdglfgrlphlvkle
lkrnqltgiepnafegashiqelqlgenkikeisnkmflglhqlktlnlydnqiscvmpg
sfehlnsltslnlasnpfncnchlawfaewlrkkslnggaarcgapskvrdvqikdlphs
efkcssegc

SCOP Domain Coordinates for d1w8aa_:

Click to download the PDB-style file with coordinates for d1w8aa_.
(The format of our PDB-style files is described here.)

Timeline for d1w8aa_: