Lineage for d1w88i_ (1w88 I:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534799Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 534800Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (1 family) (S)
  5. 534801Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (3 proteins)
  6. 534809Protein E3/E1 binding domain of dihydrolipoyl acetyltransferase [47011] (1 species)
  7. 534810Species Bacillus stearothermophilus [TaxId:1422] [47012] (5 PDB entries)
  8. 534811Domain d1w88i_: 1w88 I: [114361]
    Other proteins in same PDB: d1w88a_, d1w88b1, d1w88b2, d1w88c_, d1w88d1, d1w88d2, d1w88e_, d1w88f1, d1w88f2, d1w88g_, d1w88h1, d1w88h2

Details for d1w88i_

PDB Entry: 1w88 (more details), 2.3 Å

PDB Description: the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2

SCOP Domain Sequences for d1w88i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w88i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus}
rviampsvrkyarekgvdirlvqgtgkngrvlkedidafl

SCOP Domain Coordinates for d1w88i_:

Click to download the PDB-style file with coordinates for d1w88i_.
(The format of our PDB-style files is described here.)

Timeline for d1w88i_: