Lineage for d1w88d2 (1w88 D:193-324)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585468Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 585469Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 585503Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
  6. 585538Protein Pyruvate dehydrogenase E1-beta, PdhB, C-terminal domain [117611] (1 species)
  7. 585539Species Bacillus stearothermophilus [TaxId:1422] [117612] (2 PDB entries)
  8. 585541Domain d1w88d2: 1w88 D:193-324 [114354]
    Other proteins in same PDB: d1w88a_, d1w88b1, d1w88c_, d1w88d1, d1w88e_, d1w88f1, d1w88g_, d1w88h1, d1w88i_, d1w88j_

Details for d1w88d2

PDB Entry: 1w88 (more details), 2.3 Å

PDB Description: the crystal structure of pyruvate dehydrogenase e1(d180n, e183q) bound to the peripheral subunit binding domain of e2

SCOP Domain Sequences for d1w88d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w88d2 c.48.1.2 (D:193-324) Pyruvate dehydrogenase E1-beta, PdhB, C-terminal domain {Bacillus stearothermophilus}
gkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqpldietiigsvek
tgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypfaqaesvwlpnfk
dvietakkvmnf

SCOP Domain Coordinates for d1w88d2:

Click to download the PDB-style file with coordinates for d1w88d2.
(The format of our PDB-style files is described here.)

Timeline for d1w88d2: