Lineage for d1w88d1 (1w88 D:1-192)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581036Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 581037Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 581162Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 581197Protein Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain [117522] (1 species)
  7. 581198Species Bacillus stearothermophilus [TaxId:1422] [117523] (2 PDB entries)
  8. 581200Domain d1w88d1: 1w88 D:1-192 [114353]
    Other proteins in same PDB: d1w88a_, d1w88b2, d1w88c_, d1w88d2, d1w88e_, d1w88f2, d1w88g_, d1w88h2, d1w88i_, d1w88j_

Details for d1w88d1

PDB Entry: 1w88 (more details), 2.3 Å

PDB Description: the crystal structure of pyruvate dehydrogenase e1(d180n, e183q) bound to the peripheral subunit binding domain of e2

SCOP Domain Sequences for d1w88d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w88d1 c.36.1.7 (D:1-192) Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain {Bacillus stearothermophilus}
aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
qevpegeytipi

SCOP Domain Coordinates for d1w88d1:

Click to download the PDB-style file with coordinates for d1w88d1.
(The format of our PDB-style files is described here.)

Timeline for d1w88d1: