Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module automatically mapped to Pfam PF02779 |
Protein Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain [117522] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [117523] (2 PDB entries) Uniprot P21874 |
Domain d1w88b1: 1w88 B:1-192 [114350] Other proteins in same PDB: d1w88a_, d1w88b2, d1w88c_, d1w88d2, d1w88e_, d1w88f2, d1w88g_, d1w88h2, d1w88i_, d1w88j_ complexed with mg, tdp |
PDB Entry: 1w88 (more details), 2.3 Å
SCOPe Domain Sequences for d1w88b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w88b1 c.36.1.7 (B:1-192) Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr qevpegeytipi
Timeline for d1w88b1: