Lineage for d1w88a_ (1w88 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108723Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 protein domains)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 2108792Protein Pyruvate dehydrogenase E1-alpha, PdhA [117525] (1 species)
  7. 2108793Species Bacillus stearothermophilus [TaxId:1422] [117526] (2 PDB entries)
    Uniprot P21873
  8. 2108798Domain d1w88a_: 1w88 A: [114349]
    Other proteins in same PDB: d1w88b1, d1w88b2, d1w88d1, d1w88d2, d1w88f1, d1w88f2, d1w88h1, d1w88h2, d1w88i_, d1w88j_
    complexed with mg, tdp

Details for d1w88a_

PDB Entry: 1w88 (more details), 2.3 Å

PDB Description: the crystal structure of pyruvate dehydrogenase e1(d180n, e183q) bound to the peripheral subunit binding domain of e2
PDB Compounds: (A:) pyruvate dehydrogenase e1 component, alpha subunit

SCOPe Domain Sequences for d1w88a_:

Sequence, based on SEQRES records: (download)

>d1w88a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]}
fqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrsi
slnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsrg
hfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgnfyqg
infagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavyaa
vkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfrkfle
akglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiyke
kesk

Sequence, based on observed residues (ATOM records): (download)

>d1w88a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]}
fqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrsi
slnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsrg
hfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgnfyqg
infagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavyaa
vkaareraingegptlietlcfrykkdplvrfrkfleakglwseeeennvieqakeeike
aikkadetpkqkvtdlisimfeelpfnlkeqyeiykekesk

SCOPe Domain Coordinates for d1w88a_:

Click to download the PDB-style file with coordinates for d1w88a_.
(The format of our PDB-style files is described here.)

Timeline for d1w88a_: