Class a: All alpha proteins [46456] (286 folds) |
Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily) 3 helices; bundle, closed, right-handed twist; up-and-down |
Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) |
Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (4 proteins) |
Protein E3/E1 binding domain of dihydrolipoyl acetyltransferase [47011] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [47012] (5 PDB entries) Uniprot P11961 118-170 Uniprot Q8VV74 128-169 |
Domain d1w85j_: 1w85 J: [114348] Other proteins in same PDB: d1w85a_, d1w85b1, d1w85b2, d1w85c_, d1w85d1, d1w85d2, d1w85e_, d1w85f1, d1w85f2, d1w85g_, d1w85h1, d1w85h2 complexed with k, mg, peg, tdp |
PDB Entry: 1w85 (more details), 2 Å
SCOPe Domain Sequences for d1w85j_:
Sequence, based on SEQRES records: (download)
>d1w85j_ a.9.1.1 (J:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} viampsvrkyarekgvdirlvqgtgkngrvlkedidafl
>d1w85j_ a.9.1.1 (J:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} viampsvrkyarekgvdigtgkngrvlkedidafl
Timeline for d1w85j_: