SCOPe 2.03: Domain d1w85f2: 1w85 F:193-324

Lineage for d1w85f2 (1w85 F:193-324)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
   automatically mapped to Pfam PF02780

6. Protein Pyruvate dehydrogenase E1-beta, PdhB, C-terminal domain [117611] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [117612] (2 PDB entries)
   Uniprot P21874

8. Domain d1w85f2: 1w85 F:193-324 [114343]
   Other proteins in same PDB: d1w85a_, d1w85b1, d1w85c_, d1w85d1, d1w85e_, d1w85f1, d1w85g_, d1w85h1, d1w85i_, d1w85j_
   complexed with k, mg, peg, tdp

Details for d1w85f2

PDB Entry: 1w85, 2 Å

PDB Description: the crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2

PDB Compounds: (F:) pyruvate dehydrogenase e1 component, beta subunit

SCOPe Domain Sequences for d1w85f2:

Sequence; same for both SEQRES and ATOM records:

>d1w85f2 c.48.1.2 (F:193-324) Pyruvate dehydrogenase E1-beta, PdhB, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
gkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqpldietiigsvek
tgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypfaqaesvwlpnfk
dvietakkvmnf

Timeline for d1w85f2:

• d1w85f2 first appeared in SCOP 1.71
  
• d1w85f2 appears in SCOPe 2.02
  
• d1w85f2 appears in SCOPe 2.04
  
• d1w85f2 appears in the current release, SCOPe 2.08