Lineage for d1w85c_ (1w85 C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361462Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1361463Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1361943Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 1361992Protein Pyruvate dehydrogenase E1-alpha, PdhA [117525] (1 species)
  7. 1361993Species Bacillus stearothermophilus [TaxId:1422] [117526] (2 PDB entries)
    Uniprot P21873
  8. 1361995Domain d1w85c_: 1w85 C: [114338]
    Other proteins in same PDB: d1w85b1, d1w85b2, d1w85d1, d1w85d2, d1w85f1, d1w85f2, d1w85h1, d1w85h2, d1w85i_, d1w85j_
    complexed with k, mg, peg, tdp

Details for d1w85c_

PDB Entry: 1w85 (more details), 2 Å

PDB Description: the crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2
PDB Compounds: (C:) pyruvate dehydrogenase e1 component, alpha subunit

SCOPe Domain Sequences for d1w85c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w85c_ c.36.1.11 (C:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]}
tfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrs
islnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsr
ghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfye
ginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavya
avkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfrkfl
eakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiyk
ekesk

SCOPe Domain Coordinates for d1w85c_:

Click to download the PDB-style file with coordinates for d1w85c_.
(The format of our PDB-style files is described here.)

Timeline for d1w85c_: