SCOPe 2.07: Domain d1w80a2: 1w80 A:825-938

Lineage for d1w80a2 (1w80 A:825-938)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
   beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet

4. Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families)

5. Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)

6. Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [55714] (10 PDB entries)
   Uniprot P17427 694-938 # 98% sequence identity

8. Domain d1w80a2: 1w80 A:825-938 [114334]
   Other proteins in same PDB: d1w80a1, d1w80a3
   complexed with two synaptojanin 1 peptides, chains P and Q
   complexed with ben, co3, dtd, so4

Details for d1w80a2

PDB Entry: 1w80, 1.9 Å

PDB Description: crystal structure of the alpha-adaptin appendage domain, from the ap2 adaptor complex, bound to 2 peptides from synaptojanin170

PDB Compounds: (A:) adapter-related protein complex 2 alpha 2 subunit

SCOPe Domain Sequences for d1w80a2:

Sequence; same for both SEQRES and ATOM records:

>d1w80a2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp
anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf

Timeline for d1w80a2:

• d1w80a2 first appeared in SCOP 1.71
  
• d1w80a2 appears in SCOPe 2.06
  
• d1w80a2 appears in the current release, SCOPe 2.08