Lineage for d1w7we_ (1w7w E:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. Species Pea (Pisum sativum) [TaxId:3888] [117948] (1 PDB entry)
    Uniprot Q9SP13 81-231
  8. Domain d1w7we_: 1w7w E: [114331]
    mutant

Details for d1w7we_

PDB Entry: 1w7w (more details), 2.8 Å

PDB Description: structure and mutational analysis of a plant mitochondrial nucleoside diphosphate kinase: identification of residues involved in serine phosphorylation and oligomerization.
PDB Compounds: (E:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1w7we_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7we_ d.58.6.1 (E:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]}
aelertfiaikpdgvqrgliseiisrferkgfklvgikvliptkqfaqqhyhdlkerpff
nglcdflssgpviamvwegegvitygrkligatdpqksapgtirgdlavvvgrniihgsd
gpetakdeiklwfkpeelvsftsnsekwiyg

SCOPe Domain Coordinates for d1w7we_ are not available.

Timeline for d1w7we_:

Domains from other chains:
(mouse over for more information)
d1w7wa_, d1w7wb_, d1w7wc_, d1w7wd_, d1w7wf_