SCOPe 2.02: Domain d1w7wc_: 1w7w C:

Lineage for d1w7wc_ (1w7w C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (21 species)

7. Species Pea (Pisum sativum) [TaxId:3888] [117948] (1 PDB entry)
   Uniprot Q9SP13 81-231

8. Domain d1w7wc_: 1w7w C: [114329]
   mutant

Details for d1w7wc_

PDB Entry: 1w7w, 2.8 Å

PDB Description: structure and mutational analysis of a plant mitochondrial nucleoside diphosphate kinase: identification of residues involved in serine phosphorylation and oligomerization.

PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1w7wc_:

Sequence; same for both SEQRES and ATOM records:

>d1w7wc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]}
aelertfiaikpdgvqrgliseiisrferkgfklvgikvliptkqfaqqhyhdlkerpff
nglcdflssgpviamvwegegvitygrkligatdpqksapgtirgdlavvvgrniihgsd
gpetakdeiklwfkpeelvsftsnsekwiyg

Timeline for d1w7wc_:

• d1w7wc_ first appeared in SCOP 1.71
  
• d1w7wc_ appears in SCOPe 2.01
  
• d1w7wc_ appears in SCOPe 2.03
  
• d1w7wc_ appears in the current release, SCOPe 2.08