Lineage for d1w7wb_ (1w7w B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603791Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 603792Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 603793Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)
  7. 603900Species Pea (Pisum sativum) [TaxId:3888] [117948] (1 PDB entry)
  8. 603902Domain d1w7wb_: 1w7w B: [114328]

Details for d1w7wb_

PDB Entry: 1w7w (more details), 2.8 Å

PDB Description: structure and mutational analysis of a plant mitochondrial nucleoside diphosphate kinase: identification of residues involved in serine phosphorylation and oligomerization.

SCOP Domain Sequences for d1w7wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7wb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum)}
aelertfiaikpdgvqrgliseiisrferkgfklvgikvliptkqfaqqhyhdlkerpff
nglcdflssgpviamvwegegvitygrkligatdpqksapgtirgdlavvvgrniihgsd
gpetakdeiklwfkpeelvsftsnsekwiy

SCOP Domain Coordinates for d1w7wb_:

Click to download the PDB-style file with coordinates for d1w7wb_.
(The format of our PDB-style files is described here.)

Timeline for d1w7wb_: