SCOPe 2.07: Domain d1w7pd1: 1w7p D:396-489

Lineage for d1w7pd1 (1w7p D:396-489)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
   duplication: tandem repeat of two "winged-helix" domains

6. Protein Vacuolar protein sorting-associated protein VPS36 [109695] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109696] (2 PDB entries)
   Uniprot Q06696 396-566

8. Domain d1w7pd1: 1w7p D:396-489 [114325]
   Other proteins in same PDB: d1w7pa1, d1w7pa2, d1w7pb1, d1w7pb2, d1w7pc1, d1w7pc2

Details for d1w7pd1

PDB Entry: 1w7p, 3.6 Å

PDB Description: the crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)

PDB Compounds: (D:) vps36p, ylr417w

SCOPe Domain Sequences for d1w7pd1:

Sequence; same for both SEQRES and ATOM records:

>d1w7pd1 a.4.5.54 (D:396-489) Vacuolar protein sorting-associated protein VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldrekflnkelfldeiareiyeftlsefkdlnsdtnymiitlvdlyamynksmrigtgli
spmemreacerfehlglnelklvkvnkrilcvts

Timeline for d1w7pd1:

• d1w7pd1 first appeared in SCOP 1.71
  
• d1w7pd1 appears in SCOPe 2.06
  
• d1w7pd1 appears in the current release, SCOPe 2.08