Lineage for d1w7pd1 (1w7p D:396-449)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533898Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
    duplication: tandem repeat of two "winged-helix" domains
  6. 533909Protein Vacuolar protein sorting-associated protein VPS36 [109695] (1 species)
  7. 533910Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109696] (2 PDB entries)
  8. 533913Domain d1w7pd1: 1w7p D:396-449 [114325]
    Other proteins in same PDB: d1w7pa1, d1w7pa2, d1w7pb1, d1w7pb2, d1w7pc1, d1w7pc2

Details for d1w7pd1

PDB Entry: 1w7p (more details), 3.6 Å

PDB Description: the crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)

SCOP Domain Sequences for d1w7pd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7pd1 a.4.5.54 (D:396-449) Vacuolar protein sorting-associated protein VPS36 {Baker's yeast (Saccharomyces cerevisiae)}
ldrekflnkelfldeiareiyeftlsefkdlnsdtnymiitlvdlyamynksmr

SCOP Domain Coordinates for d1w7pd1:

Click to download the PDB-style file with coordinates for d1w7pd1.
(The format of our PDB-style files is described here.)

Timeline for d1w7pd1: