Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins) duplication: tandem repeat of two "winged-helix" domains |
Protein Vacuolar protein sorting-associated protein VPS25 [109697] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109698] (3 PDB entries) Uniprot P47142 |
Domain d1w7pc2: 1w7p C:126-199 [114324] Other proteins in same PDB: d1w7pa1, d1w7pa2, d1w7pd1, d1w7pd2 |
PDB Entry: 1w7p (more details), 3.6 Å
SCOPe Domain Sequences for d1w7pc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w7pc2 a.4.5.54 (C:126-199) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkplcdrnr atmlkdendkviai
Timeline for d1w7pc2: