Lineage for d1w7pa2 (1w7p A:165-232)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983890Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
    duplication: tandem repeat of two "winged-helix" domains
  6. 1983915Protein Vacuolar sorting protein SNF8 [109693] (1 species)
  7. 1983916Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109694] (2 PDB entries)
    Uniprot Q12483 20-232
  8. 1983918Domain d1w7pa2: 1w7p A:165-232 [114320]
    Other proteins in same PDB: d1w7pb1, d1w7pb2, d1w7pc1, d1w7pc2, d1w7pd1, d1w7pd2

Details for d1w7pa2

PDB Entry: 1w7p (more details), 3.6 Å

PDB Description: the crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)
PDB Compounds: (A:) vps22, ypl002c

SCOPe Domain Sequences for d1w7pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7pa2 a.4.5.54 (A:165-232) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ltsdqtkileicsilgyssisllkanlgweavrsksaldemvangllwidyqggaealyw
dpswitrq

SCOPe Domain Coordinates for d1w7pa2:

Click to download the PDB-style file with coordinates for d1w7pa2.
(The format of our PDB-style files is described here.)

Timeline for d1w7pa2: