SCOPe 2.08: Domain d1w7pa1: 1w7p A:20-164

Lineage for d1w7pa1 (1w7p A:20-164)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
   duplication: tandem repeat of two "winged-helix" domains

6. Protein Vacuolar sorting protein SNF8 [109693] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109694] (2 PDB entries)
   Uniprot Q12483 20-232

8. Domain d1w7pa1: 1w7p A:20-164 [114319]
   Other proteins in same PDB: d1w7pb1, d1w7pb2, d1w7pc1, d1w7pc2, d1w7pd1, d1w7pd2
   has additional insertions and/or extensions that are not grouped together

Details for d1w7pa1

PDB Entry: 1w7p, 3.6 Å

PDB Description: the crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)

PDB Compounds: (A:) vps22, ypl002c

SCOPe Domain Sequences for d1w7pa1:

Sequence; same for both SEQRES and ATOM records:

>d1w7pa1 a.4.5.54 (A:20-164) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vnktilekqsvelrdqlmvfqerlvefakkhnselqaspefrskfmhmcssigidplslf
drdkhlftvndfyyevclkvieicrqtkdmnggvisfqelekvhfrklnvglddleksid
mlkslecfeifqirgkkflrsvpne

Timeline for d1w7pa1:

• d1w7pa1 first appeared in SCOP 1.71
  
• d1w7pa1 appears in SCOPe 2.07