Lineage for d1w7pa1 (1w7p A:20-164)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
    duplication: tandem repeat of two "winged-helix" domains
  6. Protein Vacuolar sorting protein SNF8 [109693] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109694] (2 PDB entries)
    Uniprot Q12483 20-232
  8. Domain d1w7pa1: 1w7p A:20-164 [114319]
    Other proteins in same PDB: d1w7pb1, d1w7pb2, d1w7pc1, d1w7pc2, d1w7pd1, d1w7pd2

Details for d1w7pa1

PDB Entry: 1w7p (more details), 3.6 Å

PDB Description: the crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)
PDB Compounds: (A:) vps22, ypl002c

SCOPe Domain Sequences for d1w7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7pa1 a.4.5.54 (A:20-164) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vnktilekqsvelrdqlmvfqerlvefakkhnselqaspefrskfmhmcssigidplslf
drdkhlftvndfyyevclkvieicrqtkdmnggvisfqelekvhfrklnvglddleksid
mlkslecfeifqirgkkflrsvpne

SCOPe Domain Coordinates for d1w7pa1 are not available.

Timeline for d1w7pa1:

Domains from same chain:
(mouse over for more information)
d1w7pa2
Domains from other chains:
(mouse over for more information)
d1w7pb1, d1w7pb2, d1w7pc1, d1w7pc2, d1w7pd1, d1w7pd2