![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
![]() | Protein Cytochrome c3 [48697] (7 species) contains four heme groups |
![]() | Species Desulfovibrio baculatus (Desulfomicrobium baculatus) [TaxId:899] [117036] (1 PDB entry) Uniprot Q6XCI5 # fragment |
![]() | Domain d1w7oa_: 1w7o A: [114318] complexed with hec |
PDB Entry: 1w7o (more details), 1.81 Å
SCOPe Domain Sequences for d1w7oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w7oa_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio baculatus (Desulfomicrobium baculatus) [TaxId: 899]} adapgddyvisapegmkakpkgdkpgalqktvpfphskhatvecaqchhtleadggavkk cttsgchdslefrdkanakdiklvenayhtqcidchkalkkdkkptgptacgkchttn
Timeline for d1w7oa_: