Lineage for d1w7ba_ (1w7b A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717099Protein Annexin II [116947] (2 species)
  7. 2717102Species Human (Homo sapiens) [TaxId:9606] [116948] (2 PDB entries)
    Uniprot P07355
  8. 2717103Domain d1w7ba_: 1w7b A: [114317]

Details for d1w7ba_

PDB Entry: 1w7b (more details), 1.52 Å

PDB Description: annexin a2: does it induce membrane aggregation by a new multimeric state of the protein.
PDB Compounds: (A:) annexin a2

SCOPe Domain Sequences for d1w7ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]}
psaygsvkaytnfdaerdalnietaiktkgvdevtivniltnrsneqrqdiafayqrrtk
kelasalksalsghletvilgllktpaqydaselkasmkglgtdedslieiicsrtnqel
qeinrvykemyktdlekdiisdtsgdfrklmvalakgrraedgsvidyelidqdardlyd
agvkrkgtdvpkwisimtersvphlqkvfdryksyspydmlesirkevkgdlenaflnlv
qciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdmlkirsefkrkygkslyyyiq
qdtkgdyqkallylcggdd

SCOPe Domain Coordinates for d1w7ba_:

Click to download the PDB-style file with coordinates for d1w7ba_.
(The format of our PDB-style files is described here.)

Timeline for d1w7ba_: