Lineage for d1w75a_ (1w75 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 590154Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 590155Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 590156Family c.69.1.1: Acetylcholinesterase-like [53475] (5 proteins)
  6. 590157Protein Acetylcholinesterase [53476] (5 species)
  7. 590165Species Electric ray (Torpedo californica) [53477] (41 PDB entries)
  8. 590188Domain d1w75a_: 1w75 A: [114313]

Details for d1w75a_

PDB Entry: 1w75 (more details), 2.4 Å

PDB Description: native orthorhombic form of torpedo californica acetylcholinesterase (ache)

SCOP Domain Sequences for d1w75a_:

Sequence, based on SEQRES records: (download)

>d1w75a_ c.69.1.1 (A:) Acetylcholinesterase {Electric ray (Torpedo californica)}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

Sequence, based on observed residues (ATOM records): (download)

>d1w75a_ c.69.1.1 (A:) Acetylcholinesterase {Electric ray (Torpedo californica)}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
epskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOP Domain Coordinates for d1w75a_:

Click to download the PDB-style file with coordinates for d1w75a_.
(The format of our PDB-style files is described here.)

Timeline for d1w75a_: