Lineage for d1w74b_ (1w74 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416464Protein Peptidyl-prolyl cis-trans isomerase A, PpiA [50901] (2 species)
  7. 2416475Species Mycobacterium tuberculosis [TaxId:1773] [117270] (1 PDB entry)
    Uniprot P65762
  8. 2416477Domain d1w74b_: 1w74 B: [114312]

Details for d1w74b_

PDB Entry: 1w74 (more details), 2.6 Å

PDB Description: x-ray structure of peptidyl-prolyl cis-trans isomerase a, ppia, rv0009, from mycobacterium tuberculosis.
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d1w74b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w74b_ b.62.1.1 (B:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]}
latatatlhtnrgdikialfgnhapktvanfvglaqgtkdystqnasggpsgpfydgavf
hrviqgfmiqggdptgtgrggpgykfadefhpelqfdkpyllamanagpgtngsqffitv
gktphlnrrhtifgevidaesqrvveaisktatdgndrptdpvviesitis

SCOPe Domain Coordinates for d1w74b_:

Click to download the PDB-style file with coordinates for d1w74b_.
(The format of our PDB-style files is described here.)

Timeline for d1w74b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w74a_