Lineage for d1w74b_ (1w74 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565060Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 565061Superfamily b.62.1: Cyclophilin-like [50891] (2 families) (S)
  5. 565062Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 565204Protein Peptidyl-prolyl cis-trans isomerase A, PpiA [50901] (2 species)
  7. 565214Species Mycobacterium tuberculosis [TaxId:1773] [117270] (1 PDB entry)
  8. 565216Domain d1w74b_: 1w74 B: [114312]

Details for d1w74b_

PDB Entry: 1w74 (more details), 2.6 Å

PDB Description: x-ray structure of peptidyl-prolyl cis-trans isomerase a, ppia, rv0009, from mycobacterium tuberculosis.

SCOP Domain Sequences for d1w74b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w74b_ b.62.1.1 (B:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis}
latatatlhtnrgdikialfgnhapktvanfvglaqgtkdystqnasggpsgpfydgavf
hrviqgfmiqggdptgtgrggpgykfadefhpelqfdkpyllamanagpgtngsqffitv
gktphlnrrhtifgevidaesqrvveaisktatdgndrptdpvviesitis

SCOP Domain Coordinates for d1w74b_:

Click to download the PDB-style file with coordinates for d1w74b_.
(The format of our PDB-style files is described here.)

Timeline for d1w74b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w74a_