SCOPe 2.08: Domain d1w74a_: 1w74 A:

Lineage for d1w74a_ (1w74 A:)

1. Root: SCOPe 2.08
2. Class b: All beta proteins [48724] (180 folds)
3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology
4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)
5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160
6. Protein Peptidyl-prolyl cis-trans isomerase A, PpiA [50901] (2 species)
7. Species Mycobacterium tuberculosis [TaxId:1773] [117270] (1 PDB entry)
   Uniprot P65762
8. Domain d1w74a_: 1w74 A: [114311]

Details for d1w74a_

PDB Entry: 1w74, 2.6 Å

PDB Description: x-ray structure of peptidyl-prolyl cis-trans isomerase a, ppia, rv0009, from mycobacterium tuberculosis.

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d1w74a_:

Sequence; same for both SEQRES and ATOM records:

>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]}
latatatlhtnrgdikialfgnhapktvanfvglaqgtkdystqnasggpsgpfydgavf
hrviqgfmiqggdptgtgrggpgykfadefhpelqfdkpyllamanagpgtngsqffitv
gktphlnrrhtifgevidaesqrvveaisktatdgndrptdpvviesitis

SCOPe Domain Coordinates for d1w74a_ are not available.

Timeline for d1w74a_:

• d1w74a_ first appeared in SCOP 1.71
  
• d1w74a_ appears in SCOPe 2.07