SCOPe 2.01: Domain d1w72i2: 1w72 I:114-228

Lineage for d1w72i2 (1w72 I:114-228)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1w72i2: 1w72 I:114-228 [114302]
   Other proteins in same PDB: d1w72a1, d1w72a2, d1w72b_, d1w72d1, d1w72d2, d1w72e_, d1w72h1, d1w72i1, d1w72l1, d1w72l2, d1w72m1, d1w72m2
   complexed with gol

Details for d1w72i2

PDB Entry: 1w72, 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3

PDB Compounds: (I:) hyb3 heavy chain

SCOPe Domain Sequences for d1w72i2:

Sequence; same for both SEQRES and ATOM records:

>d1w72i2 b.1.1.2 (I:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1w72i2:

• d1w72i2 first appeared in SCOP 1.71
  
• d1w72i2 appears in SCOP 1.75
  
• d1w72i2 appears in SCOPe 2.02
  
• d1w72i2 appears in the current release, SCOPe 2.08