Lineage for d1w72h2 (1w72 H:114-228)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026995Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2027002Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2027039Domain d1w72h2: 1w72 H:114-228 [114300]
    Other proteins in same PDB: d1w72a1, d1w72a2, d1w72b1, d1w72b2, d1w72d1, d1w72d2, d1w72e1, d1w72e2, d1w72h1, d1w72i1, d1w72l1, d1w72l2, d1w72m1, d1w72m2
    complexed with gol

Details for d1w72h2

PDB Entry: 1w72 (more details), 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3
PDB Compounds: (H:) hyb3 heavy chain

SCOPe Domain Sequences for d1w72h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w72h2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d1w72h2:

Click to download the PDB-style file with coordinates for d1w72h2.
(The format of our PDB-style files is described here.)

Timeline for d1w72h2: