SCOP 1.73: Domain d1w72h1: 1w72 H:1-113

Lineage for d1w72h1 (1w72 H:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (19 PDB entries)

8. Domain d1w72h1: 1w72 H:1-113 [114299]
   Other proteins in same PDB: d1w72a1, d1w72a2, d1w72b_, d1w72d1, d1w72d2, d1w72e_, d1w72h2, d1w72i2, d1w72l1, d1w72l2, d1w72m1, d1w72m2

Details for d1w72h1

PDB Entry: 1w72, 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3

PDB Compounds: (H:) hyb3 heavy chain

SCOP Domain Sequences for d1w72h1:

Sequence; same for both SEQRES and ATOM records:

>d1w72h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesggglvqpgrslrlscaasgftfddyamhwvrqapgkglewvsgiswnsgsigy
adsvkgrftisrdnaknslylqmnslraedtavyycargrgfhyyyygmdiwgqgttvtv
ss

Timeline for d1w72h1:

• d1w72h1 first appeared in SCOP 1.71
  
• d1w72h1 appears in SCOP 1.75
  
• d1w72h1 appears in the current release, SCOPe 2.08