Lineage for d1w72d2 (1w72 D:1-181)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1641840Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1641841Species Human (Homo sapiens), HLA-A1 [TaxId:9606] [117849] (1 PDB entry)
    Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor
  8. 1641843Domain d1w72d2: 1w72 D:1-181 [114297]
    Other proteins in same PDB: d1w72a1, d1w72b_, d1w72d1, d1w72e_, d1w72h1, d1w72h2, d1w72i1, d1w72i2, d1w72l1, d1w72l2, d1w72m1, d1w72m2
    complexed with gol

Details for d1w72d2

PDB Entry: 1w72 (more details), 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3
PDB Compounds: (D:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d1w72d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w72d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqkmeprapwieqegpeyw
dqetrnmkahsqtdranlgtlrgyynqsedgshtiqimygcdvgpdgrflrgyrqdaydg
kdyialnedlrswtaadmaaqitkrkweavhaaeqrrvylegrcvdglrrylengketlq
r

SCOPe Domain Coordinates for d1w72d2:

Click to download the PDB-style file with coordinates for d1w72d2.
(The format of our PDB-style files is described here.)

Timeline for d1w72d2: