Lineage for d1w72d1 (1w72 D:182-274)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2746845Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2746941Domain d1w72d1: 1w72 D:182-274 [114296]
    Other proteins in same PDB: d1w72a2, d1w72b1, d1w72b2, d1w72d2, d1w72e1, d1w72e2, d1w72h1, d1w72h2, d1w72i1, d1w72i2, d1w72l1, d1w72l2, d1w72m1, d1w72m2
    complexed with gol

Details for d1w72d1

PDB Entry: 1w72 (more details), 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3
PDB Compounds: (D:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d1w72d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w72d1 b.1.1.2 (D:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpkpltlrw

SCOPe Domain Coordinates for d1w72d1:

Click to download the PDB-style file with coordinates for d1w72d1.
(The format of our PDB-style files is described here.)

Timeline for d1w72d1: