![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein beta2-microglobulin [88600] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (157 PDB entries) |
![]() | Domain d1w72b_: 1w72 B: [114295] Other proteins in same PDB: d1w72a1, d1w72a2, d1w72d1, d1w72d2, d1w72h1, d1w72h2, d1w72i1, d1w72i2, d1w72l1, d1w72l2, d1w72m1, d1w72m2 |
PDB Entry: 1w72 (more details), 2.15 Å
SCOP Domain Sequences for d1w72b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w72b_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1w72b_: