Lineage for d1w72a2 (1w72 A:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198032Species Human (Homo sapiens), HLA-A1 [TaxId:9606] [117849] (1 PDB entry)
    Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor
  8. 1198033Domain d1w72a2: 1w72 A:1-181 [114294]
    Other proteins in same PDB: d1w72a1, d1w72b_, d1w72d1, d1w72e_, d1w72h1, d1w72h2, d1w72i1, d1w72i2, d1w72l1, d1w72l2, d1w72m1, d1w72m2
    complexed with gol

Details for d1w72a2

PDB Entry: 1w72 (more details), 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3
PDB Compounds: (A:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d1w72a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w72a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqkmeprapwieqegpeyw
dqetrnmkahsqtdranlgtlrgyynqsedgshtiqimygcdvgpdgrflrgyrqdaydg
kdyialnedlrswtaadmaaqitkrkweavhaaeqrrvylegrcvdglrrylengketlq
r

SCOPe Domain Coordinates for d1w72a2:

Click to download the PDB-style file with coordinates for d1w72a2.
(The format of our PDB-style files is described here.)

Timeline for d1w72a2: