| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) ![]() consists of single alpha-helix and irregular N-terminal tail automatically mapped to Pfam PF02315 |
| Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
| Protein Methanol dehydrogenase, light chain [48668] (3 species) |
| Species Methylobacterium extorquens [TaxId:408] [63633] (3 PDB entries) Uniprot P14775 |
| Domain d1w6sd_: 1w6s D: [114287] Other proteins in same PDB: d1w6sa_, d1w6sc_ complexed with ca, gol, pqq |
PDB Entry: 1w6s (more details), 1.2 Å
SCOPe Domain Sequences for d1w6sd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w6sd_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylobacterium extorquens [TaxId: 408]}
ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
tgkfeydvakisa
Timeline for d1w6sd_: