Lineage for d1w6sc_ (1w6s C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565921Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 565922Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (1 family) (S)
  5. 565923Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (3 proteins)
  6. 565928Protein Methanol dehydrogenase, heavy chain [51000] (3 species)
  7. 565929Species Methylobacterium extorquens [TaxId:408] [63834] (3 PDB entries)
  8. 565931Domain d1w6sc_: 1w6s C: [114286]
    Other proteins in same PDB: d1w6sb_, d1w6sd_
    complexed with ca, gol, pqq

Details for d1w6sc_

PDB Entry: 1w6s (more details), 1.2 Å

PDB Description: the high resolution structure of methanol dehydrogenase from methylobacterium extorquens

SCOP Domain Sequences for d1w6sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6sc_ b.70.1.1 (C:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens}
ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
ewdyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
fmlpykagqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksa

SCOP Domain Coordinates for d1w6sc_:

Click to download the PDB-style file with coordinates for d1w6sc_.
(The format of our PDB-style files is described here.)

Timeline for d1w6sc_: