Lineage for d1w6sc_ (1w6s C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066580Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2066581Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 protein domains)
  6. 2066588Protein Methanol dehydrogenase, heavy chain [51000] (3 species)
  7. 2066589Species Methylobacterium extorquens [TaxId:408] [63834] (3 PDB entries)
    Uniprot P16027
  8. 2066591Domain d1w6sc_: 1w6s C: [114286]
    Other proteins in same PDB: d1w6sb_, d1w6sd_
    complexed with ca, gol, pqq

Details for d1w6sc_

PDB Entry: 1w6s (more details), 1.2 Å

PDB Description: the high resolution structure of methanol dehydrogenase from methylobacterium extorquens
PDB Compounds: (C:) methanol dehydrogenase subunit 1

SCOPe Domain Sequences for d1w6sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6sc_ b.70.1.1 (C:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]}
ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
ewdyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
fmlpykagqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksa

SCOPe Domain Coordinates for d1w6sc_:

Click to download the PDB-style file with coordinates for d1w6sc_.
(The format of our PDB-style files is described here.)

Timeline for d1w6sc_: