SCOP 1.71: Domain d1w6sb_: 1w6s B:

Lineage for d1w6sb_ (1w6s B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
   not a true fold

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (1 protein)

6. Protein Methanol dehydrogenase, light chain [48668] (3 species)

7. Species Methylobacterium extorquens [TaxId:408] [63633] (3 PDB entries)

8. Domain d1w6sb_: 1w6s B: [114285]
   Other proteins in same PDB: d1w6sa_, d1w6sc_

Details for d1w6sb_

PDB Entry: 1w6s, 1.2 Å

PDB Description: the high resolution structure of methanol dehydrogenase from methylobacterium extorquens

SCOP Domain Sequences for d1w6sb_:

Sequence; same for both SEQRES and ATOM records:

>d1w6sb_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylobacterium extorquens}
ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
tgkfeydvakisa

Timeline for d1w6sb_:

• d1w6sb_ is new in SCOP 1.71
  
• d1w6sb_ appears in SCOP 1.73
  
• d1w6sb_ appears in the current release, SCOPe 2.07