![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins) |
![]() | Protein Galectin-1 [100925] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101638] (6 PDB entries) |
![]() | Domain d1w6qb_: 1w6q B: [114282] complexed with bme; mutant |
PDB Entry: 1w6q (more details), 2.1 Å
SCOP Domain Sequences for d1w6qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w6qb_ b.29.1.3 (B:) Galectin-1 {Human (Homo sapiens)} acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnhlnleainym aadgdfkikcvafd
Timeline for d1w6qb_: