Lineage for d1w6qb_ (1w6q B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. Protein Galectin-1 [100925] (5 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [101638] (32 PDB entries)
    Uniprot P09382
  8. Domain d1w6qb_: 1w6q B: [114282]
    complexed with bme

Details for d1w6qb_

PDB Entry: 1w6q (more details), 2.1 Å

PDB Description: x-ray crystal structure of r111h human galectin-1
PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d1w6qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6qb_ b.29.1.3 (B:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnhlnleainym
aadgdfkikcvafd

SCOPe Domain Coordinates for d1w6qb_ are not available.

Timeline for d1w6qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w6qa_