Lineage for d1w6qa_ (1w6q A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663732Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)
  6. 663749Protein Galectin-1 [100925] (4 species)
  7. 663766Species Human (Homo sapiens) [TaxId:9606] [101638] (6 PDB entries)
  8. 663777Domain d1w6qa_: 1w6q A: [114281]

Details for d1w6qa_

PDB Entry: 1w6q (more details), 2.1 Å

PDB Description: x-ray crystal structure of r111h human galectin-1
PDB Compounds: (A:) galectin-1

SCOP Domain Sequences for d1w6qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6qa_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnhlnleainym
aadgdfkikcvafd

SCOP Domain Coordinates for d1w6qa_:

Click to download the PDB-style file with coordinates for d1w6qa_.
(The format of our PDB-style files is described here.)

Timeline for d1w6qa_: