SCOP 1.71: Domain d1w6qa_: 1w6q A:

Lineage for d1w6qa_ (1w6q A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)

6. Protein Galectin-1 [100925] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (6 PDB entries)

8. Domain d1w6qa_: 1w6q A: [114281]

Details for d1w6qa_

PDB Entry: 1w6q, 2.1 Å

PDB Description: x-ray crystal structure of r111h human galectin-1

SCOP Domain Sequences for d1w6qa_:

Sequence; same for both SEQRES and ATOM records:

>d1w6qa_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens)}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnhlnleainym
aadgdfkikcvafd

Timeline for d1w6qa_:

• d1w6qa_ is new in SCOP 1.71
  
• d1w6qa_ appears in SCOP 1.73
  
• d1w6qa_ appears in the current release, SCOPe 2.08