SCOPe 2.08: Domain d1w6qa_: 1w6q A:

Lineage for d1w6qa_ (1w6q A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (33 PDB entries)
   Uniprot P09382

8. Domain d1w6qa_: 1w6q A: [114281]
   complexed with bme

Details for d1w6qa_

PDB Entry: 1w6q, 2.1 Å

PDB Description: x-ray crystal structure of r111h human galectin-1

PDB Compounds: (A:) galectin-1

SCOPe Domain Sequences for d1w6qa_:

Sequence; same for both SEQRES and ATOM records:

>d1w6qa_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnhlnleainym
aadgdfkikcvafd

Timeline for d1w6qa_:

• d1w6qa_ first appeared in SCOP 1.71
  
• d1w6qa_ appears in SCOPe 2.07