Lineage for d1w6pb_ (1w6p B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2388863Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2388881Protein Galectin-1 [100925] (5 species)
  7. 2388898Species Human (Homo sapiens) [TaxId:9606] [101638] (32 PDB entries)
    Uniprot P09382
  8. 2388920Domain d1w6pb_: 1w6p B: [114280]
    complexed with bme, so4

Details for d1w6pb_

PDB Entry: 1w6p (more details), 1.8 Å

PDB Description: x-ray crystal structure of c2s human galectin-1 complexed with n- acetyl-lactosamine
PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d1w6pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6pb_ b.29.1.3 (B:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

SCOPe Domain Coordinates for d1w6pb_:

Click to download the PDB-style file with coordinates for d1w6pb_.
(The format of our PDB-style files is described here.)

Timeline for d1w6pb_: