Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein Galectin-1 [100925] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [101638] (27 PDB entries) Uniprot P09382 |
Domain d1w6na_: 1w6n A: [114275] complexed with bme, so4 |
PDB Entry: 1w6n (more details), 1.65 Å
SCOPe Domain Sequences for d1w6na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w6na_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]} asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym aadgdfkikcvafd
Timeline for d1w6na_: