SCOP 1.75: Domain d1w6na_: 1w6n A:

Lineage for d1w6na_ (1w6n A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)

6. Protein Galectin-1 [100925] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (6 PDB entries)
   Uniprot P09382

8. Domain d1w6na_: 1w6n A: [114275]

Details for d1w6na_

PDB Entry: 1w6n, 1.65 Å

PDB Description: x-ray crystal structure of c2s human galectin-1

PDB Compounds: (A:) galectin-1

SCOP Domain Sequences for d1w6na_:

Sequence; same for both SEQRES and ATOM records:

>d1w6na_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

Timeline for d1w6na_:

• d1w6na_ first appeared in SCOP 1.71
  
• d1w6na_ appears in SCOP 1.73
  
• d1w6na_ appears in SCOPe 2.01
  
• d1w6na_ appears in the current release, SCOPe 2.08